DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6282 and si:ch211-210c8.6

DIOPT Version :9

Sequence 1:NP_001261595.1 Gene:CG6282 / 38985 FlyBaseID:FBgn0035914 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_021325693.1 Gene:si:ch211-210c8.6 / 564023 ZFINID:ZDB-GENE-030131-3630 Length:277 Species:Danio rerio


Alignment Length:252 Identity:87/252 - (34%)
Similarity:145/252 - (57%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SLQLVFFLINSVLQMDKLTDFAGGVNFIIISLLTFFLGQIDRPSKAYDSRQLMVTLFVCLWGARL 84
            ::|.|.:.:....:.:|..|.||...||:::.|:...|      .:...||.:.|..|..||.||
Zfish    32 AIQWVGWALACSFKTEKFYDLAGSGTFILLAHLSRVWG------GSGHLRQNVQTGLVTAWGLRL 90

  Fly    85 SGYLLYRIVKLGRDKQFEDTRRNIIRYAVFWTFQAVWVYIVSLPVIIINSPRHSQPRAPKTMTTL 149
            ..:|..||:|.|:|::|.:.|.:...:.|:||.||:||::..||.:|:||.|..:|..|:     
Zfish    91 GTFLFLRILKEGQDRRFNNVRDSPGTFFVYWTMQALWVFVTLLPTLILNSERRDEPLGPR----- 150

  Fly   150 DSTGTGMFIVGLLAETYADLQKFSFRQDPANQGKFCNDGLWSVSRHPNYFGEVVIWWGIFAISLN 214
            |..|.|::.:|...|..||.||::|:.||.|.|||.:.|||:.||||||.||::.|.|:|..:.:
Zfish   151 DYIGWGIWGLGFATEAIADQQKWNFKNDPDNVGKFIHHGLWAYSRHPNYLGEILQWSGLFLSASS 215

  Fly   215 VISGHEWVAIASPIFTTMIILFLSGIPLRERSADEKYKDQLEYRKYKASTSPLIPVP 271
            ::.|.::::..||:|...::..:||||:.|:.|.:|:.....::.|..:|..|.|.|
Zfish   216 IMQGPQYLSALSPLFVWFLLRHVSGIPILEKQAMKKWGSDPAFQNYVKNTPLLWPFP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6282NP_001261595.1 DUF1295 25..264 CDD:284403 81/238 (34%)
si:ch211-210c8.6XP_021325693.1 PEMT 37..265 CDD:328764 81/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596239
Domainoid 1 1.000 163 1.000 Domainoid score I3942
eggNOG 1 0.900 - - E1_COG3752
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4138
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008184
OrthoInspector 1 1.000 - - oto40377
orthoMCL 1 0.900 - - OOG6_102460
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17356
SonicParanoid 1 1.000 - - X6148
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.680

Return to query results.
Submit another query.