DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6282 and XB5780651

DIOPT Version :9

Sequence 1:NP_001261595.1 Gene:CG6282 / 38985 FlyBaseID:FBgn0035914 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001120097.1 Gene:XB5780651 / 100145110 XenbaseID:XB-GENE-5780652 Length:255 Species:Xenopus tropicalis


Alignment Length:259 Identity:88/259 - (33%)
Similarity:147/259 - (56%) Gaps:12/259 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FAISAIVVGSLQLVFFLINSVLQMDKLTDFAGGVNFIIISLLTFFLGQIDRPSKAYDSRQLMVTL 75
            ||...:.|| :|.|.:::.::|..:|..|.||...||:::.|:.      :.:.|...||.:.|.
 Frog     6 FACLGLSVG-IQWVLWVVAALLHTEKFYDLAGSGTFILLAHLSL------QWTGARYLRQQIQTG 63

  Fly    76 FVCLWGARLSGYLLYRIVKLGRDKQFEDTRRNIIRYAVFWTFQAVWVYIVSLPVIIINSPRHSQP 140
            .:.:||.||..:|..||::.|.|::|...|.|...:.::||.|.:|:::..||.:::|..:..:|
 Frog    64 LITIWGVRLGTFLFLRILRDGHDRRFNGVRDNPRTFLIYWTMQGIWIFVTLLPSLMLNLEKRDKP 128

  Fly   141 RAPKTMTTLDSTGTGMFIVGLLAETYADLQKFSFRQDPANQGKFCNDGLWSVSRHPNYFGEVVIW 205
                 :...|..|..::.||.:.:..||.||:|||.||.|.|.|...|||:.||||||.||::.|
 Frog   129 -----LGLRDFLGWSLWTVGFITQATADQQKWSFRSDPDNMGTFIQSGLWAYSRHPNYLGEILQW 188

  Fly   206 WGIFAISLNVISGHEWVAIASPIFTTMIILFLSGIPLRERSADEKYKDQLEYRKYKASTSPLIP 269
            .|:|..:..|:||.:.|:|.||:|...::.::||||:.||.|.:::..:..|:.|...|..|.|
 Frog   189 SGLFLSASTVLSGFQLVSIISPVFVWFLLSYVSGIPILERQALKRWGSEAAYQSYVQRTPVLWP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6282NP_001261595.1 DUF1295 25..264 CDD:284403 79/238 (33%)
XB5780651NP_001120097.1 PEMT 19..247 CDD:389781 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 165 1.000 Domainoid score I3883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I3984
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008184
OrthoInspector 1 1.000 - - oto105375
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17356
SonicParanoid 1 1.000 - - X6148
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.