DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5989 and LETM1

DIOPT Version :9

Sequence 1:NP_648242.1 Gene:CG5989 / 38984 FlyBaseID:FBgn0017429 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001030897.1 Gene:LETM1 / 825151 AraportID:AT3G59820 Length:760 Species:Arabidopsis thaliana


Alignment Length:358 Identity:66/358 - (18%)
Similarity:136/358 - (37%) Gaps:73/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SKKPEDEKRKELDTVKSKR-------DQMRDNMQDYIFTRYFNYVKNYDKVLEKNFPKAMQLYRV 158
            :||||:|.:|..:..|:::       ||..:::...........::...||......:|..:...
plant   117 AKKPEEEDKKVDELAKNRKEASPEECDQAVESLSSVKAKAKAKRLQESKKVARSIVQRAWAIVLK 181

  Fly   159 FFDGVK-------------------DFFGDMKRF------------------LKIARIANDSPQG 186
            ....:|                   :|...:|.:                  ||:|        |
plant   182 IGPAIKAVASMNRADWAKKLTHWKHEFVSTLKHYWLGTKLLWADTRISSRLLLKLA--------G 238

  Fly   187 IRALNRQELELYMQMPRDMMKVAPALIGCSLPMVGYAFFPLVFYYPRSFLTAHFWTPQQRSEFQS 251
            .::|:|:|.:...:...|:.::.|..:...:|.:.:.....:..:| :.|.:.|....:..|   
plant   239 GKSLSRRERQQLTRTTADIFRLVPFAVFILVPFMEFLLPVFLKLFP-NMLPSTFQDKMKEEE--- 299

  Fly   252 YYMKRRLCNNKDVFRCLQDKLKATASHPKHSAFADI----------LGQLGSGTHPTPEMLIDVK 306
             .:||:|....:..:.||:..:..|...|||...::          |.::..|.....:.|:...
plant   300 -ALKRKLLARIEYAKFLQETAREMAKEVKHSRTGEVKQTAEDLDEFLDKVRRGQIVHNDELLGFA 363

  Fly   307 DIFAEGPYSLLGMSRKHVRNLVNLHGLP---SSIFKRHRLHEHAFLVHYMDQAITREGGVHNLTP 368
            .:|.: ..:|..:||..:.::....|:.   :..:.|:.|.:....:...|:.|..| ||.:|:.
plant   364 KLFND-ELTLDNISRPRLVSMCKYMGISPYGTDAYLRYMLRKRLRSIKEDDKLIRAE-GVDSLSE 426

  Fly   369 DALRYSCYLRGLNPDSLSSEAMIEWLRKWVKVS 401
            ..||..|..||: ...:|.|.|.:.||.|:.:|
plant   427 AELREDCRERGM-LGLVSVEEMRQQLRDWMDLS 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5989NP_648242.1 LETM1 150..403 CDD:285063 55/302 (18%)
LETM1NP_001030897.1 LETM1 208..463 CDD:285063 53/267 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14009
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.