DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5989 and Letmd1

DIOPT Version :9

Sequence 1:NP_648242.1 Gene:CG5989 / 38984 FlyBaseID:FBgn0017429 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_598854.1 Gene:Letmd1 / 68614 MGIID:1915864 Length:360 Species:Mus musculus


Alignment Length:311 Identity:91/311 - (29%)
Similarity:154/311 - (49%) Gaps:22/311 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NMQDYIFTRYFNYVKNYDKVLEKNFPKAMQLYRVFFDGVKDFFGDMKRFLKIARIANDS-PQGIR 188
            |:..|:.|:......:|.:.|.::||:...||..|..|::..:.|.|   |..||..|. .|.::
Mouse    55 NLISYVVTKTRAINGSYHRFLGRHFPRFYALYTTFMKGIQMLWADGK---KARRIKADMWKQNLK 116

  Fly   189 --ALNRQELELYMQMPRDMMK-VAPALIGCSLPMVGYAFFPLVFYYPRSFLTAHFWTPQQRSEFQ 250
              .|:.:|:|...|..||:.| :...||... |...|..|.|::.:||..|..|||||:|:.:|.
Mouse   117 FHQLSYREMEHLRQFRRDITKCLFVGLISIP-PFANYLVFLLMYLFPRQLLVKHFWTPKQQIDFL 180

  Fly   251 SYYMKRRLCNNKDVFRCLQDKLKATASHPK-HSAFADILGQLGSGTHPTPEMLIDVKDIFAEGPY 314
            ..|...|..::.:|...|: :.....||.| .....|:..::.|||||..:.::.::|.|:..| 
Mouse   181 DVYHGLRRRSHSEVITHLR-RASTFVSHEKLRRQLTDLCTKVQSGTHPAAQDVLALRDCFSTYP- 243

  Fly   315 SLLGMSRKHVRNLVNLHG-------LPSSIFKRHRLHEHAFLVHYMDQAITREGGVHNLTPDALR 372
              ||.|:.....:..|..       ||..:. |.||..|..::|.:|:|:.:. |:..||...::
Mouse   244 --LGFSQLQASQMRALSQAMLLTPYLPPPLL-RQRLKSHTTVIHQLDRALAKL-GIGQLTAQEVK 304

  Fly   373 YSCYLRGLNPDSLSSEAMIEWLRKWVKVSTSIQGEHITLFLHLPILLGYNH 423
            .:|||||||...::.:....||.:|:.:|.|::...::|.||..:||..|:
Mouse   305 SACYLRGLNSTHIADDRCRAWLGEWLHISCSLKEPELSLLLHNVVLLSTNY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5989NP_648242.1 LETM1 150..403 CDD:285063 78/264 (30%)
Letmd1NP_598854.1 Required and sufficient for mitochondrial import. /evidence=ECO:0000250 1..110 16/57 (28%)
LETM1 80..338 CDD:285063 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837953
Domainoid 1 1.000 119 1.000 Domainoid score I5800
eggNOG 1 0.900 - - E1_KOG4263
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9128
Inparanoid 1 1.050 132 1.000 Inparanoid score I4601
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49830
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007243
OrthoInspector 1 1.000 - - oto92595
orthoMCL 1 0.900 - - OOG6_107505
Panther 1 1.100 - - LDO PTHR14009
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4074
SonicParanoid 1 1.000 - - X5346
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.