DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5989 and Letm1

DIOPT Version :9

Sequence 1:NP_648242.1 Gene:CG5989 / 38984 FlyBaseID:FBgn0017429 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_611922.1 Gene:Letm1 / 37912 FlyBaseID:FBgn0284252 Length:1013 Species:Drosophila melanogaster


Alignment Length:298 Identity:66/298 - (22%)
Similarity:126/298 - (42%) Gaps:31/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KNYDKVLEKNFPKAMQLYRVFFDGVKDFFGDMKRFLKIA-------RIANDSPQGIRALNRQELE 196
            |..||.:.|  ||.....|::.:.|..:.|....|:.:|       |:.|.     :.|.|:|.:
  Fly   168 KTADKSVAK--PKKPLRTRIWDELVHYYHGFRLLFIDVAICSKLLWRVLNG-----KTLTRRENK 225

  Fly   197 LYMQMPRDMMKVAPALIGCSLPMVGYAFFPLVFYYPRSFLTAHFWTPQQRSEFQSYYMKRRLCNN 261
            ...:...|:.::.|..:...:|.: ....||...:....|.:.|.|...|.|    .:::.|...
  Fly   226 QLQRTTSDLFRLIPFSVFIIVPFM-ELLLPLFIKFFPGMLPSTFQTSTDRQE----KLRQSLSVR 285

  Fly   262 KDVFRCLQDKL-KATASHPKHSA-----FADILGQLGSGTHP-TPEMLIDVKDIFAEGPYSLLGM 319
            .:|.:.||..| :....|.:||:     |.....::.:.|.| :.:.:|.....| :...:|..:
  Fly   286 LEVAKFLQQTLDQMPVQHKEHSSEEAKQFEAFFTKIRNPTEPVSNDEIIKFAKRF-DDEITLDSL 349

  Fly   320 SRKHVRNL---VNLHGLPSSIFKRHRLHEHAFLVHYMDQAITREGGVHNLTPDALRYSCYLRGLN 381
            ||:.:..|   :.|:.:.::...|.:|......:...|:.|.|| ||.:|....|:.:|..||:.
  Fly   350 SREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIARE-GVDSLDLLELQQACKARGMR 413

  Fly   382 PDSLSSEAMIEWLRKWVKVSTSIQGEHITLFLHLPILL 419
            ...|:.|.:...|::|:.:|.:.|.....|.|...:|:
  Fly   414 AYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5989NP_648242.1 LETM1 150..403 CDD:285063 58/269 (22%)
Letm1NP_611922.1 LETM1 184..438 CDD:285063 56/265 (21%)
EFh 774..>823 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.