DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5989 and mdm28

DIOPT Version :9

Sequence 1:NP_648242.1 Gene:CG5989 / 38984 FlyBaseID:FBgn0017429 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_593648.1 Gene:mdm28 / 2541952 PomBaseID:SPAC23C11.17 Length:485 Species:Schizosaccharomyces pombe


Alignment Length:385 Identity:83/385 - (21%)
Similarity:146/385 - (37%) Gaps:82/385 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PIEKPKVRPS--------SS---SSTQPTPSKKPEDEKRKELDTVKSKRDQMRDNMQDYIFTRYF 135
            |::..|..||        ||   |:..|||||..|..|:...:..|.                  
pombe    63 PVKFNKYSPSDIVFYNIGSSRLYSTETPTPSKVKEAPKQVAAEETKP------------------ 109

  Fly   136 NYVKNYDKVLEKNFPKAMQLYRV------FFDGVKDFFGDMKRFLKIA-RIANDSPQGIRALNRQ 193
                  ..|::|  |...|  ||      |:||.|....::|...|:. ::|    .|.....|:
pombe   110 ------TTVVKK--PSIWQ--RVKGGVLHFWDGTKLLGVEIKISSKLVYKMA----VGYELTRRE 160

  Fly   194 ELELYMQMPRDMMKVAPALIGCSLPM------VGYAFFPLVFYYPRSFLTAHFWTPQQRSEFQSY 252
            ..:|...: :|:.::.|..:...:|.      :....||       :.|.:.|...:.:...::.
pombe   161 SRQLTRTL-KDIGRLVPFSVFVVVPFAELLLPIAVKLFP-------NLLPSTFEDAKDKEAKKAQ 217

  Fly   253 YMKRRLCNNKDVFRCLQDKLKA---TASHPKHSA--FADILGQL-GSGTHPTPEMLIDVKDIFAE 311
            ..|.|    .:|...|:..||:   |.|:....:  |.|...:: .||..|:.|.||:|...|.:
pombe   218 LRKTR----NEVSNMLRSTLKSGKFTFSNETRESKEFRDFFQKVRTSGQSPSREELIEVCKYFKD 278

  Fly   312 GPYSLLGMSRKHVRNL---VNLHGLPSSIFKRHRLHEHAFLVHYMDQAITREGGVHNLTPDALRY 373
             ..:|..:||..:..:   :||:...:....|:.:......:...|:||..| |:::|:...|..
pombe   279 -DITLDNLSRAQLVAMCRYMNLNAFGTDPLLRYNIRHRMRQIRRDDRAIYIE-GINSLSIPELFN 341

  Fly   374 SCYLRGLNPDSLSSEAMIEWLRKWVKVSTSIQGEHITLFLHLPILLGYN---HPNNWKTI 430
            :|..||:....||...:.|.|..|:.:........:.|.|......|||   :.:.|..:
pombe   342 ACNSRGIRTQGLSPAKLKEELSVWLDMRIKHGIPSVILMLSNAFSYGYNEGTYDSRWDAL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5989NP_648242.1 LETM1 150..403 CDD:285063 60/274 (22%)
mdm28NP_593648.1 LETM1 120..374 CDD:285063 59/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.