| Sequence 1: | NP_648242.1 | Gene: | CG5989 / 38984 | FlyBaseID: | FBgn0017429 | Length: | 436 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_506381.1 | Gene: | letm-1 / 179854 | WormBaseID: | WBGene00010279 | Length: | 784 | Species: | Caenorhabditis elegans |
| Alignment Length: | 45 | Identity: | 12/45 - (26%) |
|---|---|---|---|
| Similarity: | 20/45 - (44%) | Gaps: | 12/45 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 58 ITITSRDADAAEEEEVVLQITGDEHDEKEEDGEDLFNDNFLDDYR 102 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5989 | NP_648242.1 | LETM1_RBD | 190..418 | CDD:462258 | |
| letm-1 | NP_506381.1 | LETM1_RBD | 129..353 | CDD:462258 | |
| PLN03229 | <479..684 | CDD:178768 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||