DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and RPL14A

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_012920.1 Gene:RPL14A / 853864 SGDID:S000001489 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:46/128 - (35%)
Similarity:68/128 - (53%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAP 69
            |.|:.||:.....|...|:|.|||::|||.:||:|||..|||||...|..:.||......|..|.
Yeast    13 RLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTFALPRGAR 77

  Fly    70 TRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKK 132
            |..|.|.|..:.:..:|..|.|:.|.....:|::|.||:||::...::|:.       .|:||
Yeast    78 TATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQVMVLRKQKR-------YTVKK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 31/73 (42%)
Ribosomal_L14e 46..120 CDD:307859 23/73 (32%)
RPL14ANP_012920.1 KOW_RPL14 15..88 CDD:240512 31/72 (43%)
Ribosomal_L14e 54..128 CDD:396491 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345892
Domainoid 1 1.000 48 1.000 Domainoid score I2992
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1553
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54536
OrthoFinder 1 1.000 - - FOG0002787
OrthoInspector 1 1.000 - - otm46706
orthoMCL 1 0.900 - - OOG6_100966
Panther 1 1.100 - - O PTHR11127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1876
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.