DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and RPL6B

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_013553.1 Gene:RPL6B / 851169 SGDID:S000004440 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:28/147 - (19%)
Similarity:59/147 - (40%) Gaps:45/147 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVR 74
            |.:....||..:|:.|..:..::.|.:||.||        :::|.:.|.:...::.....|::  
Yeast    37 GTVLILLAGRFRGKRVVYLKHLEDNTLLVTGP--------FKVNGVPLRRVNARYVIATSTKV-- 91

  Fly    75 KAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKKRTKADGT 139
                             ||:..|:         ::|.:.|..::  ||      |.|::.:|:..
Yeast    92 -----------------SVEGVNV---------EKFNVEYFAKE--KL------TKKEKKEANLF 122

  Fly   140 PRVLKKD-RRERLRAEK 155
            |....|: :.||:..:|
Yeast   123 PEQQTKEIKTERVEDQK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 13/70 (19%)
Ribosomal_L14e 46..120 CDD:307859 8/73 (11%)
RPL6BNP_013553.1 KOW_RPL6 26..176 CDD:240520 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.