DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and AT2G20450

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_179635.1 Gene:AT2G20450 / 816564 AraportID:AT2G20450 Length:134 Species:Arabidopsis thaliana


Alignment Length:136 Identity:52/136 - (38%)
Similarity:77/136 - (56%) Gaps:2/136 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFP 65
            |.|:|||:.||:|..:.|...|:||.||||:||||.|||.|  .:.|.:..|..|.||...|...
plant     1 MGFKRFVEIGRVALVNYGEDYGKLVVIVDVVDQNRALVDAP--DMERIQMNLKRLSLTDIVIDIN 63

  Fly    66 YTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTL 130
            .....:::.:|..::|:|.:|:.|.|..|.....:|::||||||||:..||.:|..::......|
plant    64 RVPKKKVLIEAMEKADVKNKWEKSSWGRKLIVQKRRAALNDFDRFKIMLAKIKRAGIVRQELAKL 128

  Fly   131 KKRTKA 136
            |:...|
plant   129 KREIAA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 27/73 (37%)
Ribosomal_L14e 46..120 CDD:307859 24/73 (33%)
AT2G20450NP_179635.1 Ribosomal_L14e 3..126 CDD:421510 48/124 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4338
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68375
Inparanoid 1 1.050 88 1.000 Inparanoid score I2302
OMA 1 1.010 - - QHG54536
OrthoDB 1 1.010 - - D1433759at2759
OrthoFinder 1 1.000 - - FOG0002787
OrthoInspector 1 1.000 - - otm2705
orthoMCL 1 0.900 - - OOG6_100966
Panther 1 1.100 - - O PTHR11127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1876
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.