DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and LOC680579

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_038948669.1 Gene:LOC680579 / 680579 RGDID:1590581 Length:208 Species:Rattus norvegicus


Alignment Length:178 Identity:66/178 - (37%)
Similarity:103/178 - (57%) Gaps:14/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFP 65
            |.|.|||:.||:|..|.|...|:||:.||||||||.|||||.|.|.||......:.||.:|::|.
  Rat     1 MVFRRFVEVGRVAYISFGSHAGKLVSFVDVIDQNRALVDGPCTRVRRQAMPFKCMQLTDFRLRFT 65

  Fly    66 YTAPTRIVRKAWTESDLKAQWKVSPWS--VKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFN 128
            .:|..:.|||||.::|:..:...:.|:  :.|:.  :::.:.||||||:..||:.||:::.....
  Rat    66 CSACQKYVRKAWEKADINTKSAATRWAKIIDARE--RKAKMTDFDRFKVIKAKKMRNRIIKTEVK 128

  Fly   129 TLKKRTKADGTPR---VLK------KDRRERLRAEKAKG-GKKAAAKK 166
            .|::......:|:   |.|      ...:.::.|:||.| |:||.|:|
  Rat   129 KLQRAALLKASPKKAAVAKAAIAAAAATKAKVPAKKATGPGQKAPAQK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 36/73 (49%)
Ribosomal_L14e 46..120 CDD:307859 23/75 (31%)
LOC680579XP_038948669.1 Ribosomal_L14e 2..128 CDD:421510 52/127 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I9995
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4547
OMA 1 1.010 - - QHG54536
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002787
OrthoInspector 1 1.000 - - otm45044
orthoMCL 1 0.900 - - OOG6_100966
Panther 1 1.100 - - O PTHR11127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1876
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.