DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and rpl14

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001016534.1 Gene:rpl14 / 549288 XenbaseID:XB-GENE-5819035 Length:138 Species:Xenopus tropicalis


Alignment Length:132 Identity:60/132 - (45%)
Similarity:86/132 - (65%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFP 65
            |.|:|:||.||:|..|.||..|:||||||||||||.|||||.|||.||......:.||.:.||.|
 Frog     1 MVFKRYVQIGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGPCTGVRRQAMPFKCMQLTDFVIKVP 65

  Fly    66 YTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTL 130
            ::|..:.||:||.::::..:|..|.|:.|.....:::.:.||||:|:..||:.|||::......|
 Frog    66 HSARQKYVRRAWEKANVNEKWTASNWAKKIDARQRKAKMTDFDRYKVMKAKKMRNKIIRHEMKKL 130

  Fly   131 KK 132
            :|
 Frog   131 QK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 41/73 (56%)
Ribosomal_L14e 46..120 CDD:307859 23/73 (32%)
rpl14NP_001016534.1 Ribosomal_L14e 2..128 CDD:391751 57/125 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9808
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68375
Inparanoid 1 1.050 123 1.000 Inparanoid score I4582
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1433759at2759
OrthoFinder 1 1.000 - - FOG0002787
OrthoInspector 1 1.000 - - oto103158
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1876
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.