DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and RpL27

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001262966.1 Gene:RpL27 / 43103 FlyBaseID:FBgn0039359 Length:135 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:56/159 - (35%) Gaps:39/159 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRI-KFPYTA 68
            :.::.|:|....:|...||...||...|.          |.|.:.:.    |.....| ::|   
  Fly     3 KIMKQGKIVIVLSGRYAGRKAIIVKTHDD----------GTPEKPFG----HALVAGIDRYP--- 50

  Fly    69 PTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKKR 133
              |.|.|...::.||.:.||.|:         ..|||.......||....      |:|..|..:
  Fly    51 --RKVTKKMGKNKLKKKSKVKPF---------LKSLNYNHLMPTRYTAHD------ISFEKLSPK 98

  Fly   134 TKADGTPRVLKKDR-RERLRAEKA-KGGK 160
            ...|...|  |..| :.|::.|.. |.||
  Fly    99 DLKDPVKR--KTHRFQTRVKFESVYKEGK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 16/74 (22%)
Ribosomal_L14e 46..120 CDD:307859 17/74 (23%)
RpL27NP_001262966.1 KOW 1..135 CDD:412330 38/159 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.