DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and rpl14

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001002866.1 Gene:rpl14 / 323365 ZFINID:ZDB-GENE-030131-2085 Length:139 Species:Danio rerio


Alignment Length:162 Identity:67/162 - (41%)
Similarity:95/162 - (58%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFP 65
            |.|:|||:.||:|..:.||.:|:||||||||||||.|||||.|||.||......|.||.|.||.|
Zfish     1 MVFKRFVEIGRVAFIAFGPHEGKLVAIVDVIDQNRALVDGPCTGVKRQALPFKCLQLTDYVIKVP 65

  Fly    66 YTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTL 130
            :....:.||:||.::::..:|:.|.|:.|.:...||::::||||:|:..||:.|||::       
Zfish    66 HRNRQKYVRRAWEKAEISKKWEESSWAKKIEARKKRAAMSDFDRYKVSKAKKMRNKII------- 123

  Fly   131 KKRTKADGTPRVLKKDRRERLRAEKAKGGKKA 162
                            |.|..:.:||...|||
Zfish   124 ----------------RHEMKKLQKAAAQKKA 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 40/73 (55%)
Ribosomal_L14e 46..120 CDD:307859 26/73 (36%)
rpl14NP_001002866.1 PTZ00065 2..128 CDD:240252 61/148 (41%)
KOW_RPL14 7..81 CDD:240512 40/73 (55%)
Ribosomal_L14e 46..120 CDD:280163 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594336
Domainoid 1 1.000 65 1.000 Domainoid score I10100
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68375
Inparanoid 1 1.050 128 1.000 Inparanoid score I4643
OMA 1 1.010 - - QHG54536
OrthoDB 1 1.010 - - D1433759at2759
OrthoFinder 1 1.000 - - FOG0002787
OrthoInspector 1 1.000 - - oto39706
orthoMCL 1 0.900 - - OOG6_100966
Panther 1 1.100 - - LDO PTHR11127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1109
SonicParanoid 1 1.000 - - X1876
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.