DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and rpl14

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_593924.1 Gene:rpl14 / 2542425 PomBaseID:SPAC1805.13 Length:134 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:50/134 - (37%)
Similarity:74/134 - (55%) Gaps:3/134 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYT 67
            |:|:|:.||:...:.|...|:|..|||::|..|.|:|.|.:..|||..|..::.||...:|.|..
pombe     4 FKRYVEVGRVVLVTKGEYTGKLAVIVDIVDHKRALIDSPCSEFPRQVIRYGSVVLTHIVMKLPRG 68

  Fly    68 APTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKK 132
            |.:.||.|.|...|:..:|..|.|:.|.:....||.|||||||.:...|:||.:.:.:|   :.|
pombe    69 ARSGIVAKKWKAQDVCNKWASSAWAKKLEAKKVRSQLNDFDRFAVMRLKKQRREQVNVA---VAK 130

  Fly   133 RTKA 136
            ..||
pombe   131 ALKA 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 27/73 (37%)
Ribosomal_L14e 46..120 CDD:307859 29/73 (40%)
rpl14NP_593924.1 RPL14A 4..128 CDD:225074 47/126 (37%)
KOW_RPL14 8..82 CDD:240512 27/73 (37%)
Ribosomal_L14e 47..121 CDD:280163 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3178
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1706
OMA 1 1.010 - - QHG54536
OrthoFinder 1 1.000 - - FOG0002787
OrthoInspector 1 1.000 - - oto100927
orthoMCL 1 0.900 - - OOG6_100966
Panther 1 1.100 - - LDO PTHR11127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1109
SonicParanoid 1 1.000 - - X1876
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.