DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and Rpl6

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_035420.2 Gene:Rpl6 / 19988 MGIID:108057 Length:296 Species:Mus musculus


Alignment Length:149 Identity:33/149 - (22%)
Similarity:56/149 - (37%) Gaps:44/149 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PFERFVQ-------TGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTK 59
            ||.:.|:       .|.:.....|..:|:.|..:..:|...:||.|||.        :|.:.|.:
Mouse   140 PFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVTGPLV--------INRVPLRR 196

  Fly    60 YRIKFPYTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLT 124
            ...||.....|::     ..||:|              |.|..:...|.:.:||..:.|..::  
Mouse   197 THQKFVIATSTKV-----DISDVK--------------IPKHLTDAYFKKKQLRKPRHQEGEI-- 240

  Fly   125 IAFNTLKKR------TKAD 137
              |:|.|::      .|||
Mouse   241 --FDTEKEKYEITEQRKAD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 16/80 (20%)
Ribosomal_L14e 46..120 CDD:307859 14/73 (19%)
Rpl6NP_035420.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
Ribosomal_L6e_N 50..103 CDD:367701
KOW_RPL6 144..296 CDD:240520 31/145 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.