DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL14 and rpl-27

DIOPT Version :9

Sequence 1:NP_523975.1 Gene:RpL14 / 38983 FlyBaseID:FBgn0017579 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001367687.1 Gene:rpl-27 / 171750 WormBaseID:WBGene00004441 Length:136 Species:Caenorhabditis elegans


Alignment Length:133 Identity:24/133 - (18%)
Similarity:55/133 - (41%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFVQTGRIAKASAGPLKGRLVAIVDVIDQ---NRVLVDGPLTGVPRQEYRL------------NN 54
            :.::.|::.....|...||...:|...|:   :|......:.|:.|...::            |.
 Worm     3 KIMKPGKVVLVLRGKYAGRKAVVVKQQDEGVSDRTYPHAIIAGIDRYPLKVTKDMGKKKIEKRNK 67

  Fly    55 LHLTKYRIKFPYTAPTRI-VRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQ 118
            |......:.:.:..|||. |..|:.::::..:      ::||.:..:::.:....:|:.|| |..
 Worm    68 LKPFLKVVSYTHLLPTRYSVDVAFDKTNINKE------ALKAPSKKRKALVEVKSKFEERY-KTG 125

  Fly   119 RNK 121
            :||
 Worm   126 KNK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL14NP_523975.1 KOW_RPL14 7..81 CDD:240512 16/89 (18%)
Ribosomal_L14e 46..120 CDD:307859 14/86 (16%)
rpl-27NP_001367687.1 KOW_RPL27 6..88 CDD:240514 14/81 (17%)
Ribosomal_L27e 52..136 CDD:396371 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.