DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhea and tlnrd1

DIOPT Version :9

Sequence 1:NP_001246674.1 Gene:rhea / 38978 FlyBaseID:FBgn0260442 Length:2836 Species:Drosophila melanogaster
Sequence 2:XP_005166423.1 Gene:tlnrd1 / 100003148 ZFINID:ZDB-GENE-130103-2 Length:354 Species:Danio rerio


Alignment Length:306 Identity:65/306 - (21%)
Similarity:139/306 - (45%) Gaps:16/306 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1373 CDNAMRNIEALRLMLDYPHEPINELG------YFDCVEQATGKSRNLGYAISEMINNAKQSQHVE 1431
            |.:.|:.:..|.|:.......:|..|      :..|.:....:::.|...:.::.:.....:.:|
Zfish    35 CKSKMQLVADLLLLSSETRPVVNTEGQPVAETFEKCRDTVIARTKELSIIVHDIQSQLNMGKFLE 99

  Fly  1432 FSQSVNNVNDSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIV---SS 1493
            ....:..:.|.:..|.|.|:.||||..|..|.|.|...|::|:.::|.....:.|.|:|:   :.
Zfish   100 VGDRLVEMGDLVVSLTEYSAHAAYLAAVEIPGSQAAVSGLVDRYKVTRCRHEVEQTCNILRLTAV 164

  Fly  1494 QQSTKPQMISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEE 1558
            ...|.|.::.....|.|:.:.|......||..:.:..||.:|....|.::|:.:.|:..::.::.
Zfish   165 GDLTPPLLLEVSQNILKNLTMLTDASSLASDKSKDKFAKEQFKASVKCMSTSATALLACVRELKA 229

  Fly  1559 QSAGGSRERLV---DPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEM 1620
            ..:..:|.|.|   .||::||.|:..:|:..:|....|.|:.:|:..|..|:.....|:...|.:
Zfish   230 CPSELTRNRCVLFSGPLIQAVHALVGFATEPQFLGKAASITPDGKGVQTAVLGGAMSVVSACVLL 294

  Fly  1621 VKAAKSLALTPDNP---PVW-QQLSMHSTPVSESVKRLVDNIRDKA 1662
            .:..:.::..|::.   ||: ::|...:..||:....|...:|:::
Zfish   295 TQGLRDISQHPESSQQMPVYRERLRNSACAVSDGCTLLSQALRERS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rheaNP_001246674.1 FERM_f0 4..85 CDD:293120
B41 89..322 CDD:214604
FERM_N 92..147 CDD:286467
FERM_M 215..322 CDD:278785
FERM_C_Talin 318..409 CDD:269973
Talin_middle 510..668 CDD:286254
I_LWEQ 686..>778 CDD:302998
Vinculin <874..>1035 CDD:279395
talin-RS 1661..1832 CDD:213393 0/2 (0%)
Tar <1694..2005 CDD:223910
VBS 1859..1982 CDD:286057
I_LWEQ 2392..2534 CDD:279885
tlnrd1XP_005166423.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4261
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.