DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Slc39a11

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001349866.1 Gene:Slc39a11 / 69806 MGIID:1917056 Length:416 Species:Mus musculus


Alignment Length:190 Identity:47/190 - (24%)
Similarity:80/190 - (42%) Gaps:50/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 SHHGHSHRHGHVHSPPETLSAVAW----MIIMGDGLHNFTDGMAIGAAF-------------AEN 569
            |.||.|.:.|          ..:|    ::|:...:||..:|:|:|..|             |.|
Mouse   252 SMHGSSGQPG----------GSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATFESARN 306

  Fly   570 IAGG-----FSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFG-IAFGQ 628
            :|.|     |...|||   .||        |..||.|...|.:|..|:|::..:..:|| .|...
Mouse   307 LAIGIGIQNFPEGLAV---SLP--------LRGAGFSTWKAFWYGQLSGMVEPLAGVFGAFAVVL 360

  Fly   629 SQDVAQWMFAVAAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIMLLIALYEG 688
            ::.:..:..|.|||..:|:.:.|::||...|...      ::....|.:|.:::::|..|
Mouse   361 AEPILPYALAFAAGAMVYVVMDDIIPEAQISGNG------KLASWASILGFVVMMSLDVG 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 45/184 (24%)
Slc39a11NP_001349866.1 ZupT 80..416 CDD:223505 47/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.