DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Zip99C

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001189313.1 Gene:Zip99C / 43533 FlyBaseID:FBgn0039714 Length:355 Species:Drosophila melanogaster


Alignment Length:443 Identity:94/443 - (21%)
Similarity:164/443 - (37%) Gaps:145/443 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 WIYAFISVFACGILGLVGVAIIPF---MGSRYYK-----YIIQYLVALAVGTMTGDALLHLLPHS 317
            |:::.:.....|:.|:..:.|||.   |....||     .:::.|::.|||.:.||..|||||.:
  Fly    36 WVFSLLGSVVIGLSGIFPLIIIPTEEKMAKEGYKDPADSKLLRVLLSFAVGGLLGDVFLHLLPEA 100

  Fly   318 LAGQDE----RGMIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSV 378
            ..|.::    ...:..||..|.||:.|.::|                                  
  Fly   101 WEGDNQDPSSHPSLRSGLWVLSGILIFTIVE---------------------------------- 131

  Fly   379 NNSVAGDKICKQKYSSYPYCYDEITMNNKQSEWMHLPFDVAAGAGGDAPSVAELRNGVGDHDGSN 443
                   ||    :|.|....:|    |.|                  |...|:           
  Fly   132 -------KI----FSGYASADEE----NPQ------------------PKCVEI----------- 152

  Fly   444 DMAAAAESLISPLHTNCVEMNHHNHNHKHNSHQQNHEGQDSNTIVTDLDGNAVYAVNKAKDKDSR 508
                          .||:...|..         |..||:.|.:.     |.|.         |..
  Fly   153 --------------ANCLLRRHGG---------QLPEGETSESC-----GGAC---------DIE 180

  Fly   509 NDHVTVILREHESSHHGHSHRHGHVHSPPETLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGG 573
            :......|||.|........:       |:.::  .::.::.:.:.|||.|:|:..:|..:...|
  Fly   181 DVGKVCFLREQEQKSKERKEQ-------PKKVA--GYLNLLANSIDNFTHGLAVAGSFLVSFRHG 236

  Fly   574 FSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQS------QDV 632
            ...:.|:..||:|||:||||||:::|.|...|....|||.....:|.:  :|.|.|      :..
  Fly   237 ILATFAILLHEIPHEVGDFAILLRSGFSRWDAARAQLLTAGAGLLGAL--VAIGGSGVTSAMEAR 299

  Fly   633 AQWMFAVAAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIMLLIAL 685
            ..|:....||.|::||||.::|:: ...:...:.:.|:|.::.|:.:|.::.:
  Fly   300 TSWIMPFTAGGFLHIALVTVLPDL-LKEEERKESIKQLLALVFGIALMAVMTM 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 94/440 (21%)
Zip99CNP_001189313.1 Zip 34..350 CDD:280666 94/440 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 127 1.000 Inparanoid score I1444
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.