DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Zip48C

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster


Alignment Length:313 Identity:73/313 - (23%)
Similarity:115/313 - (36%) Gaps:102/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 MAAAAESLISPLHTNCVEMNHHNH---------------------------------NHKHNSHQ 476
            :||:..||:.|    .:||...:|                                 |..:...|
  Fly    52 IAASFWSLLKP----AIEMAESSHLYGVYAFLPVAGGFLLGSIFVYGCDKLMSYLGLNSTNMMIQ 112

  Fly   477 QNHEGQDSNTIVTDLDGNAVYAVNKA-KDKDSRNDHVTVILREHESSHHGHSHRHGH-------- 532
            .......::..:.|...|.|.....| |..||.:|.::|       .|.|.|.|...        
  Fly   113 MTQSKAKADIAIEDSKRNGVAPDRLASKSLDSFSDCLSV-------QHSGESRRRKKGASINEME 170

  Fly   533 --VHSPPE-------TLSAVAW----MIIMGDGLHNFTDGMAIGAAF-------------AENIA 571
              .::.||       .||  .|    ::::...:||..:|:|:|.:|             |.|:|
  Fly   171 QCTYTTPEEQQRAEDALS--QWKRIMLLVVAITVHNIPEGLAVGVSFGAIGSTNSSTFESARNLA 233

  Fly   572 GG-----FSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLS-FIGMIFGIAFGQSQ 630
            .|     |...|||   .||        |..||.|||.|::|..|:|::. ..|::..:|...:.
  Fly   234 IGIGIQNFPEGLAV---SLP--------LHAAGFSVKRALWYGQLSGMVEPIFGVLGAVAVTFAN 287

  Fly   631 DVAQWMFAVAAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIMLLI 683
            .:..:..:.|||..|||...|::||..||    |...:...|.:||..||:.:
  Fly   288 LILPYALSFAAGAMIYIVSDDILPEAHAS----GNGTIATWGTVSGFLIMMCL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 73/313 (23%)
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 73/313 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.