DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Zip42C.1

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_525107.1 Gene:Zip42C.1 / 35579 FlyBaseID:FBgn0033096 Length:352 Species:Drosophila melanogaster


Alignment Length:182 Identity:47/182 - (25%)
Similarity:73/182 - (40%) Gaps:32/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 HSHRHGHVHSP---PETLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPH 587
            |...|||.|.|   .:..||....||:...||...:|||||      :.|..||...:|.....|
  Fly   179 HKDHHGHSHMPVPADDGSSARGLGIILALSLHELFEGMAIG------LEGTVSTVWFMFGAVSAH 237

  Fly   588 ELGDFAILIKAGMSV-------KSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQW--------MF 637
            :|   .:....||.:       ..|:.|.:...:::.||:  |:..|.||.||..        :.
  Fly   238 KL---VLAFCVGMELLVARTRSSLAILYLVTFSIVTPIGI--GVGLGISQQVAAGQPSLPSGVLQ 297

  Fly   638 AVAAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIMLLIALYEGD 689
            .:|.|..:|:...:::.|   ||......:..:.|.....|:.:|....|||
  Fly   298 GIACGTLLYVVFFEILIE---SHAGWRALVAAVAGFALMFGLQILSDEAEGD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 44/175 (25%)
Zip42C.1NP_525107.1 Zip 21..336 CDD:280666 42/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.