DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Slc39a3

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001008357.1 Gene:Slc39a3 / 314637 RGDID:1310863 Length:317 Species:Rattus norvegicus


Alignment Length:196 Identity:37/196 - (18%)
Similarity:76/196 - (38%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 EHES-------SHHG-------HSH----------RHGHVHSPPETLSAVAWMIIMGDGLHNFTD 558
            |:||       .:||       |||          |.|    |...||     ::.....|:..:
  Rat   132 EYESPFVGVGGRNHGLYPEPTAHSHGTGLRLRELGRPG----PLRLLS-----LVFALSAHSVFE 187

  Fly   559 GMAIG-AAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIF 622
            |:|:| ....|.:...|   :.|..||....:.....:.::.:.::.|....:....:..:|:..
  Rat   188 GLALGLQEEGERVVSLF---VGVAVHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGL 249

  Fly   623 GIAFGQSQDVAQ-----WMFAVAAGLFIYIALVDMM-PEISASHKSLGQFLLQILGMLSGVGIML 681
            |:....::.||.     .:..:|.|.|:::..:::: .|:....:.|.:.|..:||.....|::.
  Rat   250 GLGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGMVF 314

  Fly   682 L 682
            |
  Rat   315 L 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 37/196 (19%)
Slc39a3NP_001008357.1 Zip 5..312 CDD:396884 35/191 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.