DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Slc39a13

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:XP_038960439.1 Gene:Slc39a13 / 295928 RGDID:1304695 Length:395 Species:Rattus norvegicus


Alignment Length:532 Identity:105/532 - (19%)
Similarity:187/532 - (35%) Gaps:204/532 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LSDKDLLHLCPILLYELKAQSGGCIEPAILS-------DIDTTEE-----LLEAEKDKDIFYVWI 262
            ::.:.||.| .:|..||..::||. :||:.|       .:|:.|.     ||..|:    ...||
  Rat    11 MAGQRLLFL-TVLALELLERAGGS-QPALRSLGAAAACRLDSKESESWGALLSGER----LDTWI 69

  Fly   263 YAFISVFACGILGLVGVAIIPF-MG----SRYYKYIIQYLVALAVGTMTGDALLHLLPHSLA--- 319
            .:.:.....|:.|:..:.:||. ||    |....:.::.|::.|:|.:.|:..|||||.:.|   
  Rat    70 CSLLGSLMVGLSGVFPLLVIPLEMGTMLQSEAGAWRLKQLLSFALGGLLGNVFLHLLPEAWAYTC 134

  Fly   320 -------GQDERGMIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSS 377
                   ||..:.....||..:.|.:.|..:|.......|          :.||:|. .:||.::
  Rat   135 NISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKE----------EDPSQAP-SKDPTAA 188

  Fly   378 V---------------------NNSVAGDKICKQKYSSYPYCYDEITMNNKQSEWMHLPFDVAAG 421
            .                     |..|:|.  |     ..|.|       :.::||:         
  Rat   189 ALNGGHCLAQPAAEPGLRAVVRNLKVSGP--C-----GPPSC-------SCRAEWL--------- 230

  Fly   422 AGGDAPSVAELRNGVGDHDGSNDMAAAAESLISPLHTNCVEMNHHNHNHKHNSHQQNHEGQDSNT 486
                                 ..:.....:.:|||                              
  Rat   231 ---------------------TQLCLPGSAWLSPL------------------------------ 244

  Fly   487 IVTDLDGNAVYAVNKAKDKDSRNDHVTVILREHESSHHGHSHRHGHVHSPPETLSAVAWMIIMGD 551
                                                                 :....::.::.:
  Rat   245 -----------------------------------------------------IQVSGYLNLLAN 256

  Fly   552 GLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLS 616
            .:.|||.|:|:.|:|..:...|..|::|:..||:|||:||||||::||....:|......|.:..
  Rat   257 TIDNFTHGLAVAASFLVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWTAAKLQFSTALGG 321

  Fly   617 FIGMIFGIAFGQSQDVAQ---WMFAVAAGLFIYIALVDMMPEISAS----HKSLGQFLLQILGML 674
            .:|..|.|.....:.|.:   |.....:|.|:|:|||:::|::...    |.     |.|:|.:.
  Rat   322 LLGACFAICTQSPKGVEETVVWTLPFTSGGFLYVALVNVLPDLLEEDDPWHS-----LQQVLLLC 381

  Fly   675 SGVGIMLLIALY 686
            ||:.:|:|::|:
  Rat   382 SGIVVMVLLSLF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 88/468 (19%)
Slc39a13XP_038960439.1 Zip 65..390 CDD:396884 87/467 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.