DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and Slc39a11

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:XP_006247726.1 Gene:Slc39a11 / 287796 RGDID:1311981 Length:374 Species:Rattus norvegicus


Alignment Length:260 Identity:58/260 - (22%)
Similarity:98/260 - (37%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 GQDSNT-IVTDLDGNAVYAVNKAKDKDSRNDHVTVILREHESS-------------HHGHSHRH- 530
            |:|..| :..:||...|       .|....|..:::..|.|.|             .:|..::. 
  Rat   137 GEDPQTALALNLDPALV-------KKSDLKDPASLLFPERELSIRIGSTVLLSDKRENGEVYQRK 194

  Fly   531 --------------GHVHSPPETLSAVAW----MIIMGDGLHNFTDGMAIGAAF----------- 566
                          |.||.........:|    ::|:...:||..:|:|:|..|           
  Rat   195 KLAATDFPEGAAPSGPVHGNSGQPGVSSWRRIALLILAITIHNIPEGLAVGVGFGAVEKTASATF 259

  Fly   567 --AENIAGG-----FSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFG- 623
              |.|:|.|     |...|||   .||        |..||.|...|.:|..|:|::..:..:|| 
  Rat   260 ESARNLAIGIGIQNFPEGLAV---SLP--------LRGAGFSTWKAFWYGQLSGMVEPLAGVFGA 313

  Fly   624 IAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIMLLIALYEG 688
            .|...::.|..:..|.|||..:|:.:.|::||...|...      ::....|.:|.:::::|..|
  Rat   314 FAVVLAEPVLPYALAFAAGAMVYVVMDDIIPEAQISGNG------KLASWASILGFVVMMSLDVG 372

  Fly   689  688
              Rat   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 56/254 (22%)
Slc39a11XP_006247726.1 ZupT 38..374 CDD:223505 58/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.