DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and zipt-3

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_495126.1 Gene:zipt-3 / 173969 WormBaseID:WBGene00015940 Length:363 Species:Caenorhabditis elegans


Alignment Length:265 Identity:61/265 - (23%)
Similarity:111/265 - (41%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 HNHKHNSHQQNHEGQDSNTIVTDLDGNAVYAVNKAKDKDSRNDHV----------TVILREHESS 522
            :.|.|:.|             :.|..:....:||..|::...|||          .:|.|::.|.
 Worm   114 NGHSHSGH-------------SPLATSDSIKMNKFHDEEEGEDHVPLVAMDDDADEIIFRQNTSP 165

  Fly   523 HHGHSHRHGHVHSPP-ETLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGF-STSLAVFCHEL 585
            || |:...||..:.| .:::...|.:::|..:|:|.:|:|:|   .:|.:..| ...:||..||:
 Worm   166 HH-HAPSSGHCRTAPGGSMNIRVWFLLLGMSVHSFFEGVALG---VQNDSNAFWQILIAVLFHEV 226

  Fly   586 PHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAF-GQSQDVAQ-----WMFAVAAGLF 644
            ...:.....|.|...|.|.|...::........|||..... |...|:.|     |:..:|||.|
 Worm   227 LCCVSYGVQLAKHNASRKYAWTSSIFLSATIPAGMILATTIDGIENDMWQRIGRYWLEGLAAGTF 291

  Fly   645 IYIALVDMMP---------------------EISASHKSLGQ----FLLQILGMLSGVGIMLLIA 684
            :::|||:::|                     :.:.||.:...    .|::.|.:.:|:||.::|.
 Worm   292 VHVALVELLPMELHSDDSGEGGHGHSHNVIADTTHSHSNHSSSHWISLVKSLFVAAGIGIFVIIK 356

  Fly   685 LYEGD 689
            ...|:
 Worm   357 SLIGE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 59/258 (23%)
zipt-3NP_495126.1 Zip 4..355 CDD:280666 59/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.