DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foi and slc39a13

DIOPT Version :9

Sequence 1:NP_001261584.1 Gene:foi / 38976 FlyBaseID:FBgn0024236 Length:706 Species:Drosophila melanogaster
Sequence 2:XP_017948773.2 Gene:slc39a13 / 100494023 XenbaseID:XB-GENE-996260 Length:340 Species:Xenopus tropicalis


Alignment Length:501 Identity:114/501 - (22%)
Similarity:181/501 - (36%) Gaps:205/501 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LLHLCPI-LLYELKAQ----SGGCIEPAILSDIDTTEELLEAEKDKDIFYVWIYAFISVFACGIL 274
            :|.||.| |.::|.|.    |..| |||.||.:|                .||.:.|.....|:.
 Frog    12 ILLLCLICLAFQLSATCPPGSRAC-EPASLSSLD----------------AWICSIIGSLLVGLS 59

  Fly   275 GLVGVAIIPF-----MGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAG------------QD 322
            |:..:.:||.     :.|......::.|::.|:|.:.||..|||||.:.|.            |.
 Frog    60 GVFPLLVIPIEAGAELRSEKNSQRLKRLLSFAIGGLLGDVFLHLLPEAWAYTCSATTGSYQSLQQ 124

  Fly   323 ERGMIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVNNSVAGDKI 387
            :|   :.||..:.|.:.|.::|.  |.:.|.|:  |:.::..|..||                  
 Frog   125 QR---LLGLWVITGFLSFLLLEK--TFLDEKRE--EQVDSTTPKEAK------------------ 164

  Fly   388 CKQKYSSYPYCYDEITMNNKQSEWMHLPFDVAAGAGGDAPSVAELRNGVGDHDGSNDMAAAAESL 452
                                                                          |||
 Frog   165 --------------------------------------------------------------ESL 167

  Fly   453 ISPLHTNCVEMNHHNHNHKHNSHQQNHEGQDSNTIVTDLDGNAVYAVNKAKDKDSRNDHVTVILR 517
            |             |..||||..|                |:.:        |...|||:.|   
 Frog   168 I-------------NGKHKHNGKQ----------------GSPI--------KKPPNDHIKV--- 192

  Fly   518 EHESSHHGHSHRHGHVHSPPETLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFC 582
                        .|:::             ::.:.:.|||.|||:..:|..:...|..|::|:..
 Frog   193 ------------SGYLN-------------LLANTIDNFTHGMAVAGSFLVSRKVGILTTVAILL 232

  Fly   583 HELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAF--------GQSQDVAQWMFAV 639
            ||:|||:||||||::||....:|....|.|.    :|.|.|.||        |..:.|| |:...
 Frog   233 HEIPHEVGDFAILLRAGFDRWNAARLQLTTA----MGGILGAAFALCAQSPKGAGEAVA-WILPF 292

  Fly   640 AAGLFIYIALVDMMPEISASHKSLGQFLLQILGMLSGVGIMLLIAL 685
            .:|.|:|||||.::|:: ...|::.....|:|.:..|:.:|.:::|
 Frog   293 TSGGFLYIALVTVLPDL-IEEKNIRNSFGQVLLICCGIAVMTILSL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foiNP_001261584.1 Zip 258..684 CDD:280666 98/450 (22%)
slc39a13XP_017948773.2 Zip 43..335 CDD:396884 99/465 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D657777at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.