powered by:
Protein Alignment GstO1 and CAM1
DIOPT Version :9
Sequence 1: | NP_648237.1 |
Gene: | GstO1 / 38975 |
FlyBaseID: | FBgn0035907 |
Length: | 254 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015277.1 |
Gene: | CAM1 / 856059 |
SGDID: | S000005969 |
Length: | 415 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 56 |
Identity: | 15/56 - (26%) |
Similarity: | 23/56 - (41%) |
Gaps: | 21/56 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 WFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEK 115
||:.|.:| |.|.: :|.|.|:.:.||.|.. ||.::|
Yeast 191 WFNTVRAS--------------PFLKD-----EYKDFKFADKPLSPPQ--KKKEKK 225
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345040 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.