DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and CAM1

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:56 Identity:15/56 - (26%)
Similarity:23/56 - (41%) Gaps:21/56 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEK 115
            ||:.|.:|              |.|.:     :|.|.|:.:.||.|..  ||.::|
Yeast   191 WFNTVRAS--------------PFLKD-----EYKDFKFADKPLSPPQ--KKKEKK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 7/34 (21%)
GstA 22..216 CDD:223698 15/56 (27%)
GST_C_Omega 109..234 CDD:198293 3/7 (43%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342
GST_C_EF1Bgamma_like 92..214 CDD:198290 9/41 (22%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.