DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU20

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_177958.1 Gene:GSTU20 / 844173 AraportID:AT1G78370 Length:217 Species:Arabidopsis thaliana


Alignment Length:167 Identity:45/167 - (26%)
Similarity:72/167 - (43%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KVPALELVKEQGNPVLIESLIICDYLDEKYPEV-PLYPKDLLKKAQEKI---LIERFGQFINAFY 129
            |:|.|   ...|.|| .|||.:..|:||.:||. |.:|.|...:||.:.   .:::  :|.:|.:
plant    53 KIPVL---VHNGKPV-CESLNVVQYVDEAWPEKNPFFPSDPYGRAQARFWADFVDK--KFTDAQF 111

  Fly   130 YLLLHDNPEQLVDTDHYAGLV-VYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQK 193
            .:......||......:...| :.|.||..:  .:|||||.|.:|..:..:...|.:  |.....
plant   112 KVWGKKGEEQEAGKKEFIEAVKILESELGDK--PYFGGDSFGYVDISLITFSSWFQA--YEKFGN 172

  Fly   194 FELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKY 230
            |.:..|. |.||.|....::..:|.....|.:....|
plant   173 FSIESES-PKLIAWAKRCMEKESVSKSLPDSEKIVAY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 10/25 (40%)
GstA 22..216 CDD:223698 42/151 (28%)
GST_C_Omega 109..234 CDD:198293 28/126 (22%)
GSTU20NP_177958.1 GST_N_Tau 6..78 CDD:239356 12/28 (43%)
GST_C_Tau 89..209 CDD:198294 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.