DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU22

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_177956.1 Gene:GSTU22 / 844169 AraportID:AT1G78340 Length:218 Species:Arabidopsis thaliana


Alignment Length:202 Identity:51/202 - (25%)
Similarity:85/202 - (42%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAHRVHLVLDAKKIPYHAIYINLRDK-PEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYL 94
            |:..|..:.|..|.:.:.....||||| |....:.....|:|.|   ...|.|| .||:.:..|:
plant    14 PFGVRARIALREKGVEFEYREENLRDKSPLLLQMNPVHKKIPVL---IHNGKPV-CESMNVVQYI 74

  Fly    95 DEKYPEV-PLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDT----------DHYAG 148
            ||.:.:. |:.|.|..::||.:..::        |....|.:..:::..|          ::...
plant    75 DEVWSDKNPILPSDPYQRAQARFWVD--------FVDTKLFEPADKIWQTKGEEQETAKKEYIEA 131

  Fly   149 LVVYEEELKRRCTKFFGGDSPGMLDYMM---WPWCERFDSLKYTFEQKFELSPERFPTLIKWRDL 210
            |.:.|.||..:  .:||||:.|.:|..|   :.|.|..:.|     ..|.:.|| .|||:.....
plant   132 LKILETELGDK--PYFGGDTFGFVDIAMTGYYSWFEASEKL-----ANFSIEPE-CPTLMASAKR 188

  Fly   211 MIQDRAV 217
            .:|..:|
plant   189 CLQRESV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 19/64 (30%)
GstA 22..216 CDD:223698 50/199 (25%)
GST_C_Omega 109..234 CDD:198293 27/122 (22%)
GSTU22NP_177956.1 GST_N_Tau 5..78 CDD:239356 21/67 (31%)
GST_C_Tau 89..212 CDD:198294 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.