DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and DHAR2

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_177662.1 Gene:DHAR2 / 843864 AraportID:AT1G75270 Length:213 Species:Arabidopsis thaliana


Alignment Length:150 Identity:52/150 - (34%)
Similarity:69/150 - (46%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYL 94
            ||::.||.|.|:.||:||....||:.|||:||..:|...|||   :||..|..| .:|.:|...|
plant    20 CPFSQRVLLTLEEKKLPYKTHLINVSDKPQWFLDISPEGKVP---VVKLDGKWV-ADSDVIVGLL 80

  Fly    95 DEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQ-LVDTDHYAGLVVYEEELKR 158
            :|||||..|...........||    ||.|:........:|..|: |||.     |...|..||.
plant    81 EEKYPEPSLKTPPEFASVGSKI----FGAFVTFLKSKDANDGSEKALVDE-----LEALENHLKT 136

  Fly   159 RCTKFFGGDSPGMLDYMMWP 178
            ....|..|:....:|..:.|
plant   137 HSGPFVAGEKITAVDLSLAP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 27/64 (42%)
GstA 22..216 CDD:223698 51/149 (34%)
GST_C_Omega 109..234 CDD:198293 17/70 (24%)
DHAR2NP_177662.1 PLN02378 1..212 CDD:166019 51/149 (34%)
GST_N_3 19..88 CDD:290153 33/71 (46%)
GST_C_DHAR 89..210 CDD:198310 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.