DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU10

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_177598.1 Gene:GSTU10 / 843799 AraportID:AT1G74590 Length:232 Species:Arabidopsis thaliana


Alignment Length:229 Identity:53/229 - (23%)
Similarity:90/229 - (39%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS---TKVPALELVKEQGNPVLIESLIICDY 93
            |:.||.:.|..|.:.|..:..:|::|.|  ||:..:   .|:|.|   ...|.|| .|||:|.:|
plant    18 YSKRVEIALKLKGVLYEYLEEDLQNKSE--SLIQLNPVHKKIPVL---VHDGKPV-AESLVILEY 76

  Fly    94 LDEKYPEVP-LYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELK 157
            :||.:...| .:|:|..::||.:..:    .:||...:.::    .|::..:..|.....||..|
plant    77 IDETWTNSPRFFPEDPYERAQVRFWV----SYINQQVFEVM----GQVMSQEGEAQAKSVEEARK 133

  Fly   158 R------RCTKFF------GGDSPGMLDY---------------------------MMWPWCERF 183
            |      ...|.|      ..|..|:|:.                           .::.|.||.
plant   134 RFKVLDEGLKKHFPNKNIRRNDDVGLLEITIIATLGGYKAHREAIGVDIIGPVNTPTLYNWIERL 198

  Fly   184 DSLKYTFEQKFELSPERFPTLI-KWRDLMIQDRA 216
            ..|...  ::.|:..:...|.| |:|...:|..|
plant   199 QDLSVI--KEVEVPHDTLVTFIQKYRQKCLQQAA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/65 (34%)
GstA 22..216 CDD:223698 52/227 (23%)
GST_C_Omega 109..234 CDD:198293 26/148 (18%)
GSTU10NP_177598.1 GST_N_Tau 8..81 CDD:239356 24/68 (35%)
GST_C_Tau 92..221 CDD:198294 22/138 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.