DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU11

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_177151.1 Gene:GSTU11 / 843329 AraportID:AT1G69930 Length:234 Species:Arabidopsis thaliana


Alignment Length:228 Identity:58/228 - (25%)
Similarity:92/228 - (40%) Gaps:52/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSST--------KVPALE 74
            :|..:||......|:..|..:.|:.|.:.|.  |:...|     :|.|.|.        ::|.| 
plant     9 NDEYVKLLGAWPSPFVLRTRIALNLKNVAYE--YLEEED-----TLSSESVLNYNPVHKQIPIL- 65

  Fly    75 LVKEQGNPVLIESLIICDYLDEKY---PEVPLYPKDLLKKAQEKILIERFGQ-FINAFYYLLLHD 135
               ..||..:.|||.|..|:||.:   |  |:.|.|...:|     :.||.. :|:...:..::.
plant    66 ---IHGNKPIRESLNIVMYVDETWLSGP--PILPSDPFDRA-----VARFWDVYIDEHCFTSING 120

  Fly   136 NPEQLVDTDHYAGLVVYE------EELKRRCTK---FFGGDSPGMLDY----MMWPW--CERFDS 185
            ......:.:..|.:...|      ||..:.|:|   ||||::.|.:|.    |:.|.  .|:|..
plant   121 VAVAKGEENINAAIAKLEQCMALLEETFQECSKGRGFFGGENIGFIDIGFGSMLGPLTVLEKFTG 185

  Fly   186 LKYTFEQKFELSPERFPTLIKWRDLMIQDRAVK 218
            :|:       :.||..|.|..|.|......|||
plant   186 VKF-------IHPENTPGLFHWADRFYAHEAVK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/84 (26%)
GstA 22..216 CDD:223698 54/220 (25%)
GST_C_Omega 109..234 CDD:198293 30/126 (24%)
GSTU11NP_177151.1 GST_N_Tau 13..86 CDD:239356 23/83 (28%)
GST_C_Tau 97..225 CDD:198294 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.