DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU15

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_176176.1 Gene:GSTU15 / 842257 AraportID:AT1G59670 Length:233 Species:Arabidopsis thaliana


Alignment Length:240 Identity:49/240 - (20%)
Similarity:87/240 - (36%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS--TKVPALELVKEQGNPVL 84
            :||....:.|...|..:.|..|.:.|..:..:|........|.|:.  .|||.|   .....||.
plant     7 VKLLGTWYSPVVIRAKIALRLKSVDYDYVEEDLFGSKSELLLKSNPIFKKVPVL---IHNTKPVC 68

  Fly    85 IESLIICDYLDEKYPE-----VPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDN--PEQLVD 142
            : ||.|.:|:||.:..     :|.:|.|               :.:..|:.:.:.|.  |..:  
plant    69 V-SLNIVEYIDETWNSSGSSILPSHPYD---------------RALARFWSVFVDDKWLPTLM-- 115

  Fly   143 TDHYAGLVVYEEELKRRCTK---------------------FFGGDSPGMLDYMMWPWCERFDSL 186
                |.:|...||.|.:..:                     ||||::.|.:|..:..:.....:.
plant   116 ----AAVVAKSEEAKAKGMEEVEEGLLQLEAAFIALSKGKSFFGGETIGFIDICLGSFLVLLKAR 176

  Fly   187 KYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYM 231
            :....:|. |...:.|:|.:|.:..:.:..||....|....||::
plant   177 EKLKNEKI-LDELKTPSLYRWANQFLSNEMVKNVVPDIDKVAKFI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/74 (27%)
GstA 22..216 CDD:223698 44/223 (20%)
GST_C_Omega 109..234 CDD:198293 24/146 (16%)
GSTU15NP_176176.1 GST_N_Tau 7..81 CDD:239356 22/77 (29%)
GST_C_Tau 93..223 CDD:198294 26/150 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.