DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU14

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_174034.1 Gene:GSTU14 / 839603 AraportID:AT1G27140 Length:243 Species:Arabidopsis thaliana


Alignment Length:202 Identity:51/202 - (25%)
Similarity:84/202 - (41%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIE 86
            :||......|::.|..:.|..|.|.|..:.....|..|...|:..|..:.....|...|:..:.|
plant     7 VKLIGCSDDPFSIRPRVALHLKSIKYEYLEEPDDDLGEKSQLLLKSNPIHKKTPVLIHGDLAICE 71

  Fly    87 SLIICDYLDEKYPEVP-LYPKDLLKKAQEKILIERFGQFIN------AFYYLLLHDNPEQLVDTD 144
            ||.|..||||.:|..| :.|.:...:|..:.    :.|:|:      |......:::.|::..|.
plant    72 SLNIVQYLDEAWPSDPSILPSNAYDRASARF----WAQYIDDKCFEAANALTGANNDEERIAATG 132

  Fly   145 HYAGLVVYEEELKRRCTK---FFGGDSPGMLDY----MMWP--WCERFDSLKYTFEQKFELSPER 200
            .....:...||..::.:|   ||||::.|.||.    ::.|  ..|.|.:.|:..|       |.
plant   133 KLTECLAILEETFQKSSKGLGFFGGETIGYLDIACAALLGPISVIEMFSADKFVRE-------ET 190

  Fly   201 FPTLIKW 207
            .|.||:|
plant   191 TPGLIQW 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 19/72 (26%)
GST_C_Omega 109..234 CDD:198293 26/114 (23%)
GSTU14NP_174034.1 GST_N_Tau 7..83 CDD:239356 22/75 (29%)
GST_C_Tau 94..224 CDD:198294 26/115 (23%)

Return to query results.
Submit another query.