DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and DHAR1

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_173387.1 Gene:DHAR1 / 838544 AraportID:AT1G19570 Length:213 Species:Arabidopsis thaliana


Alignment Length:212 Identity:57/212 - (26%)
Similarity:85/212 - (40%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYL 94
            ||::.|..|.|:.|.:.|....|||.|||:||..:|...|||.|::    .:..:.:|.:|...|
plant    20 CPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKI----DDKWVTDSDVIVGIL 80

  Fly    95 DEKYPEVPL-YPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLV---VYEEE 155
            :||||:.|| .|.:.......  :...||.|:.:          :...|...:|.||   ..|..
plant    81 EEKYPDPPLKTPAEFASVGSN--IFGTFGTFLKS----------KDSNDGSEHALLVELEALENH 133

  Fly   156 LKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWRDLMIQDRAVKCF 220
            ||.....|..|:....:|..:.|...........|  |....||.||.:..:...:        |
plant   134 LKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHF--KSWSVPESFPHVHNYMKTL--------F 188

  Fly   221 YLDG----QTHAKYMNS 233
            .||.    :|..||:.|
plant   189 SLDSFEKTKTEEKYVIS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/64 (34%)
GstA 22..216 CDD:223698 50/189 (26%)
GST_C_Omega 109..234 CDD:198293 27/132 (20%)
DHAR1NP_173387.1 PLN02378 1..213 CDD:166019 57/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.