DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU26

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_173162.1 Gene:GSTU26 / 838290 AraportID:AT1G17190 Length:220 Species:Arabidopsis thaliana


Alignment Length:227 Identity:51/227 - (22%)
Similarity:95/227 - (41%) Gaps:66/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAHRVHLVLDAKKIPYHAIYINLRDKPEWFS---LVSSS---TKVPALELVKEQGNPVLIESLII 90
            :..|..:.|..|.:.|     ..::...|..   |:..:   .|:|.|   ...|.|: .||||.
plant    16 FGMRTKMALAEKGVKY-----EYKETDPWVKTPLLIEMNPIHKKIPVL---IHNGKPI-CESLIQ 71

  Fly    91 CDYLDEKYPEV-PLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNP----------------E 138
            .:|:||.:.:. |:.|.|..:|::.:.    :.:||:..:|     :|                :
plant    72 LEYIDEVWSDASPILPSDPYQKSRARF----WAEFIDKKFY-----DPSWKVWATMGEEHAAVKK 127

  Fly   139 QLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKF-ELSPE-RF 201
            :|:  :|:..|   |.||..:  .::||:..|.||..:..:...|.::     :|| |.|.| .|
plant   128 ELL--EHFKTL---ETELGDK--PYYGGEVFGYLDIALMGYYSWFKAM-----EKFGEFSIETEF 180

  Fly   202 PTLIKW------RDLMIQ-----DRAVKCFYL 222
            |.|..|      |:.:::     ||.::..|:
plant   181 PILTTWTKRCLERESVVKALADSDRIIEYVYV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 16/68 (24%)
GstA 22..216 CDD:223698 49/219 (22%)
GST_C_Omega 109..234 CDD:198293 30/143 (21%)
GSTU26NP_173162.1 GST_N_Tau 6..79 CDD:239356 18/71 (25%)
GST_C_Tau 90..213 CDD:198294 30/144 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.