DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU25

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_173161.1 Gene:GSTU25 / 838289 AraportID:AT1G17180 Length:221 Species:Arabidopsis thaliana


Alignment Length:241 Identity:61/241 - (25%)
Similarity:100/241 - (41%) Gaps:53/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DDGILKLYSMRFCP--YAHRVHLVLDAKKIPYHAIYINLRDKPEW------FSLVSSSTKVPALE 74
            |:.||    :.|.|  :..|..:.|:.|.:.:     :.|::..|      ..:.....|:|.| 
plant     3 DEVIL----LDFWPSMFGMRTRIALEEKNVKF-----DYREQDLWNKSPILLEMNPVHKKIPVL- 57

  Fly    75 LVKEQGNPVLIESLIICDYLDEKYP-EVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPE 138
              ...|||| .||||..:|:||.:| :.||.|.|..::||.|.    :|.||:...|.     ..
plant    58 --IHNGNPV-CESLIQIEYIDEVWPSKTPLLPSDPYQRAQAKF----WGDFIDKKVYA-----SA 110

  Fly   139 QLV----DTDHYAG-------LVVYEEELKRRCTKFFGGDSPGMLDYMM---WPWCERFDSLKYT 189
            :|:    ..:|.||       |...|.||..:  .:|||::.|.:|..:   :.|.|.::..   
plant   111 RLIWGAKGEEHEAGKKEFIEILKTLESELGDK--TYFGGETFGYVDIALIGFYSWFEAYEKF--- 170

  Fly   190 FEQKFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRR 235
              ..|.:..| .|.||.|....::..:|.....|.:...|::...|
plant   171 --GSFSIEAE-CPKLIAWGKRCVERESVAKSLPDSEKIIKFVPELR 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/84 (26%)
GstA 22..216 CDD:223698 55/216 (25%)
GST_C_Omega 109..234 CDD:198293 31/138 (22%)
GSTU25NP_173161.1 GST_N_Tau 5..78 CDD:239356 23/85 (27%)
GST_C_Tau 89..209 CDD:198294 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.