DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and ERD9

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_172508.4 Gene:ERD9 / 837576 AraportID:AT1G10370 Length:227 Species:Arabidopsis thaliana


Alignment Length:218 Identity:54/218 - (24%)
Similarity:92/218 - (42%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS---TKVPALELVKEQGNPV 83
            :||......|:..|..:.|:.|.:||..:......|.|  .|:.|:   .|:|.|   .....||
plant     6 VKLIGAWASPFVMRPRIALNLKSVPYEFLQETFGSKSE--LLLKSNPVHKKIPVL---LHADKPV 65

  Fly    84 LIESLIICDYLDEKY----PEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTD 144
             .||.||.:|:|:.:    |.:  .|.|...:|..:.    :..:|:..:::.|....:...:.:
plant    66 -SESNIIVEYIDDTWSSSGPSI--LPSDPYDRAMARF----WAAYIDEKWFVALRGFLKAGGEEE 123

  Fly   145 HYAGLVVYEEE---LKRR---CTK---FFGGDSPGMLD-----YMMWPWCERFDSLKYTFEQKFE 195
            ..|.:...||.   |::.   |:|   ||.||:.|.||     ::.|   .|...|..:::   .
plant   124 KKAVIAQLEEGNAFLEKAFIDCSKGKPFFNGDNIGYLDIALGCFLAW---LRVTELAVSYK---I 182

  Fly   196 LSPERFPTLIKWRDLMIQDRAVK 218
            |...:.|:|.||.:....|.|||
plant   183 LDEAKTPSLSKWAENFCNDPAVK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/75 (29%)
GstA 22..216 CDD:223698 51/214 (24%)
GST_C_Omega 109..234 CDD:198293 28/124 (23%)
ERD9NP_172508.4 GST_N_Tau 6..79 CDD:239356 23/78 (29%)
GST_C_Tau 91..221 CDD:198294 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.