DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU18

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_172507.1 Gene:GSTU18 / 837575 AraportID:AT1G10360 Length:227 Species:Arabidopsis thaliana


Alignment Length:209 Identity:54/209 - (25%)
Similarity:81/209 - (38%) Gaps:41/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGNPVLI-------ESLI 89
            |..|..:.|..|.|.|..:......|.|   |:..|..|       .:..||||       ||.|
plant    16 YVMRARIALHLKSISYEFLQETYGSKSE---LLLKSNPV-------HKKMPVLIHADKPVCESNI 70

  Fly    90 ICDYLDEKY----PEV-PLYPKDLLKKAQEKILIERF-GQFINAFYYLLLHDNPEQLVDTDHYAG 148
            |..|:||.:    |.: |.:|.|.        .|.|| ..:|:..:::.:........|.:..|.
plant    71 IVHYIDEAWNSSGPSILPSHPYDR--------AIARFWAAYIDDQWFISVRSILTAQGDEEKKAA 127

  Fly   149 LVVYEEELK------RRCTK---FFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTL 204
            :...||..|      ..|::   ||.||..|.||..:..:...:..::.....|| |...:.|:|
plant   128 IAQVEERTKLLEKAFNDCSQGKPFFNGDHIGYLDIALGSFLGWWRVVELDANHKF-LDETKTPSL 191

  Fly   205 IKWRDLMIQDRAVK 218
            :||.:....|.|||
plant   192 VKWAERFCDDPAVK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/69 (29%)
GstA 22..216 CDD:223698 51/205 (25%)
GST_C_Omega 109..234 CDD:198293 28/120 (23%)
GSTU18NP_172507.1 GST_N_Tau 6..79 CDD:239356 22/72 (31%)
GST_C_Tau 91..221 CDD:198294 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.