DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU9

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_851249.1 Gene:GSTU9 / 836368 AraportID:AT5G62480 Length:240 Species:Arabidopsis thaliana


Alignment Length:205 Identity:45/205 - (21%)
Similarity:89/205 - (43%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS---TKVPALELVKEQGNPVLIESLIICD 92
            ||:.|:.|.|..|.|||..:..:|::|.:  :|:..:   .|:|.|   ...|.|: .|||.|.:
plant    18 PYSKRIELALRLKSIPYQFVQEDLQNKSQ--TLLRYNPVHKKIPVL---VHNGKPI-SESLFIIE 76

  Fly    93 YLDEKYPEVP-LYPKDLLKKAQEKILIERFGQFINAFYYLLL--------HDNPEQLVDTDHYAG 148
            |:||.:...| :.|:|..::::    :..:..:|....|.|:        .:..:.|.:......
plant    77 YIDETW
SNGPHILPEDPYRRSK----VRFWANYIQLHLYDLVIKVVKSEGEEQKKALTEVKEKLS 137

  Fly   149 LVVYEEELKRRCTKFFG-----GDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKWR 208
             |:.:|.||...:...|     .::..::|.:|......:.:.:.....|. :.||..|.:..|.
plant   138 -VIEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHEEVLGLKI-IDPEIVPGVYGWI 200

  Fly   209 DLMIQDRAVK 218
            :.:.:...||
plant   201 NAINETSVVK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 22/66 (33%)
GST_C_Omega 109..234 CDD:198293 18/123 (15%)
GSTU9NP_851249.1 GST_N_Tau 9..82 CDD:239356 24/69 (35%)
GST_C_Tau 93..226 CDD:198294 18/124 (15%)

Return to query results.
Submit another query.