DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTL3

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_195899.1 Gene:GSTL3 / 831798 AraportID:AT5G02790 Length:235 Species:Arabidopsis thaliana


Alignment Length:206 Identity:57/206 - (27%)
Similarity:89/206 - (43%) Gaps:30/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKI--PYHAIYINLRDKPEWF-SLVSSSTKVPAL 73
            |..:|  ||..:||:...||:|.||.:..:.|.:  ....:.::|.::|.|: ..|....|||||
plant    21 PPSLF--DGTTRLYTSYVCPFAQRVWITRNFKGLQEKIKLVPLDLGNRPAWYKEKVYPENKVPAL 83

  Fly    74 ELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPE 138
                |....::.|||.:..|||..:....|||:|..|:.....|::....|:...|..|..|..:
plant    84 ----EHNGKIIGESLDLIKYLDNTFEGPSLYPEDHAKREFGDELLKYTDTFVKTMYVSLKGDPSK 144

  Fly   139 QLVDTDHYAGLVVYEEELKRRCTKFFGGDSP------GMLDYMMWPWCERFDS-LKYTFEQKFEL 196
            :......|....:|         ||  .|.|      .::|....|:.|||.: |...|  |.::
plant   145 ETAPVLDYLENALY---------KF--DDGPFFLGQLSLVDIAYIPFIERFQTVLNELF--KCDI 196

  Fly   197 SPERFPTLIKW 207
            :.|| |.|..|
plant   197 TAER-PKLSAW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 26/85 (31%)
GstA 22..216 CDD:223698 53/196 (27%)
GST_C_Omega 109..234 CDD:198293 25/106 (24%)
GSTL3NP_195899.1 GstA 31..210 CDD:223698 53/194 (27%)
GST_N_3 31..108 CDD:290153 24/80 (30%)
GST_C_Lambda 113..231 CDD:198312 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.