DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and DHAR3

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_568336.1 Gene:DHAR3 / 831532 AraportID:AT5G16710 Length:258 Species:Arabidopsis thaliana


Alignment Length:172 Identity:48/172 - (27%)
Similarity:72/172 - (41%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPA 72
            |..||..:.....|.....:..||:..:|.|.::.|.:||....::|.:|||||..:|...|||.
plant    44 TAASPLEICVKASITTPNKLGDCPFCQKVLLTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPV 108

  Fly    73 LELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNP 137
            ::. .|:..|   :|.:|...|:|||||.||...........||    |..|:.........|..
plant   109 VKF-DEKWVP---DSDVITQALEEKYPEPPLATPPEKASVGSKI----FSTFVGFLKSKDSGDGT 165

  Fly   138 EQ-LVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWP 178
            || |:|.     |..:.:.:|.. ..|..|:.....|..:.|
plant   166 EQVLLDE-----LTTFNDYIKDN-GPFINGEKISAADLSLAP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 25/86 (29%)
GstA 22..216 CDD:223698 44/158 (28%)
GST_C_Omega 109..234 CDD:198293 15/71 (21%)
DHAR3NP_568336.1 PLN02817 3..258 CDD:166458 48/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.