DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTL2

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_191064.1 Gene:GSTL2 / 824670 AraportID:AT3G55040 Length:292 Species:Arabidopsis thaliana


Alignment Length:182 Identity:52/182 - (28%)
Similarity:80/182 - (43%) Gaps:24/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKI--PYHAIYINLRDKPEWF-SLVSSSTKVPA 72
            |.:||...||..:||....||:|.|..:..:.|.:  ....:.|:|:::|.|: ..|.|:.||||
plant    70 SSEPVQVFDGSTRLYISYTCPFAQRAWIARNYKGLQNKIELVPIDLKNRPAWYKEKVYSANKVPA 134

  Fly    73 LELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNP 137
            |    |..|.||.|||.:..|:|..:....|.|..|.|:.....|:.....|..|.        .
plant   135 L----EHNNRVLGESLDLIKYIDTNFEGPSLTPDGLEKQVVADELLSYTDSFSKAV--------R 187

  Fly   138 EQLVDTDHYAGLVVYEEELKRRCTKFFGGDSP------GMLDYMMWPWCERF 183
            ..|..||..|..|.: :.:::..:||  .:.|      .::|....|:.|||
plant   188 STLNGTDTNAADVAF-DYIEQALSKF--NEGPFFLGQFSLVDVAYAPFIERF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 31/86 (36%)
GstA 22..216 CDD:223698 47/171 (27%)
GST_C_Omega 109..234 CDD:198293 17/81 (21%)
GSTL2NP_191064.1 GstA 83..267 CDD:223698 47/169 (28%)
GST_N_3 83..160 CDD:290153 27/80 (34%)
GST_C_Lambda 167..283 CDD:198312 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.