DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU1

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_180510.1 Gene:GSTU1 / 817498 AraportID:AT2G29490 Length:224 Species:Arabidopsis thaliana


Alignment Length:209 Identity:54/209 - (25%)
Similarity:98/209 - (46%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDK-PEWFSLVSSSTKVPALELVKEQGNPVLI 85
            :||......|::.||.:.|..|.:||..:..:|.:| |....|.....|||.|    ...:.:|:
plant     8 VKLLGFWASPFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVL----VHNDKILL 68

  Fly    86 ESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFIN------AFYYLLLHDNPEQLVDTD 144
            ||.:|.:|:|:.:...|:.|:|..:||..:.    :.:||:      .|..|:..:...::...:
plant    69 ESHLILEYIDQTWKNSPILPQDPYEKAMARF----WAKFIDDQILTLGFRSLVKAEKGREVAIEE 129

  Fly   145 HYAGLVVYEEELKRRCTKFFGGDSPGMLDYM---MWPWCERFDSLKYTFEQ-KFELSP-ERFPTL 204
            ....|:..|:|:..:  .||||.:.|.||.:   |.|:|     |...::. ..::.| |:||.|
plant   130 TRELLMFLEKEVTGK--DFFGGKTIGFLDMIAGSMIPFC-----LARLWKGIGIDMIPEEKFPEL 187

  Fly   205 IKWRDLMIQDRAVK 218
            .:|...:.:..||:
plant   188 NRWIKNLEEVEAVR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 22/73 (30%)
GstA 22..216 CDD:223698 52/205 (25%)
GST_C_Omega 109..234 CDD:198293 28/121 (23%)
GSTU1NP_180510.1 GST_N_Tau 8..81 CDD:239356 23/76 (30%)
GstA 9..201 CDD:223698 53/206 (26%)
GST_C_Tau 91..217 CDD:198294 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.