DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU3

DIOPT Version :10

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_180508.1 Gene:GSTU3 / 817496 AraportID:AT2G29470 Length:225 Species:Arabidopsis thaliana


Alignment Length:229 Identity:55/229 - (24%)
Similarity:103/229 - (44%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAI---YINLRDKPEWFSLVSSSTKVPALELVKEQ 79
            ::|: ||......|::.||.:.|..|.:||..:   |:.:: .|....|.....|||.|    ..
plant     5 EEGV-KLIGSWASPFSRRVEMALKLKGVPYDYLDEDYLVVK-SPLLLQLNPVYKKVPVL----VH 63

  Fly    80 GNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTD 144
            ...:|.||.:|.:|:|:.:...|:.|:....||..:.    :.:|::....::   ....||.::
plant    64 NGKILPESQLILEYIDQTWTNNPILPQSPYDKAMARF----WAKFVDEQVTMI---GLRSLVKSE 121

  Fly   145 HYAGLVVYEEE-----LKRRCT--KFFGGDSPGMLDYM---MWPWCERFDSLKYTFE-QKFELSP 198
            ....:.:.|.:     |:.:.|  |.|||::.|.||.:   |.|:|     |...:| ...::.|
plant   122 KRIDVAIEEVQELIMLLENQITGKKLFGGETIGFLDMVVGSMIPFC-----LARAWEGMGIDMIP 181

  Fly   199 -ERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYM 231
             |:||.|.:|...:.:...|:....|.:.|.::|
plant   182 EEKFPELNRWIKNLKEIEIVRECIPDREKHIEHM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 22/79 (28%)
GST_C_Omega 109..234 CDD:198293 30/135 (22%)
GSTU3NP_180508.1 GST_N_Tau 8..82 CDD:239356 22/79 (28%)
GST_C_Tau 92..218 CDD:198294 30/136 (22%)

Return to query results.
Submit another query.