DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GSTU6

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_180505.1 Gene:GSTU6 / 817493 AraportID:AT2G29440 Length:223 Species:Arabidopsis thaliana


Alignment Length:225 Identity:54/225 - (24%)
Similarity:106/225 - (47%) Gaps:29/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSS-STKVPALELVKEQGNPVLI 85
            :||..:...|::.|:.:.|..|.:||..:..:|.:|......:|. ..|:|.|    ......:|
plant     7 VKLLGIWASPFSRRIEMALKLKGVPYEYLEEDLENKSSLLLALSPIHKKIPVL----VHNGKTII 67

  Fly    86 ESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQ-FINAFYYLLLHDNPEQLVDTDHYAGL 149
            ||.:|.:|:||.:...|:.|:|..::::.::|.:...: .:|..:..|......:.|..:....|
plant    68 ESHVILEYIDETWKHNPILPQDPFQRSKARVLAKLVDEKIVNVGFASLAKTEKGREVLIEQTREL 132

  Fly   150 VV-YEEELKRRCTKFFGGDSPGMLDYM---MWPWCERFDSLKYTFEQKFE------LSPERFPTL 204
            :: .|:||..:  .:|||.:.|.||::   |.|:|         .|:.:|      ::.::||..
plant   133 IMCLEKELAGK--DYFGGKTVGFLDFVAGSMIPFC---------LERAWEGMGVEMITEKKFPEY 186

  Fly   205 IKW-RDLMIQDRAVKCFYLDGQTHAKYMNS 233
            .|| :.|...:..|.|..| .:.|.::||:
plant   187 NKWVKKLKEVEIVVDCIPL-REKHIEHMNN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 19/73 (26%)
GstA 22..216 CDD:223698 48/206 (23%)
GST_C_Omega 109..234 CDD:198293 30/137 (22%)
GSTU6NP_180505.1 GST_N_Tau 7..80 CDD:239356 21/76 (28%)
GST_C_Tau 90..214 CDD:198294 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.