DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and Gstt4

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:97 Identity:29/97 - (29%)
Similarity:38/97 - (39%) Gaps:24/97 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VHLVLDAKKIPYHAIYINLRDK--PEWFSLV---------------SSSTKVPALELVKEQGNPV 83
            :.|.:|....|..|:||..|..  |..|..|               :...|||:|    ..|..:
  Rat     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSL----RDGKFI 63

  Fly    84 LIESLIICDYLDEKYPEVP--LYPKDLLKKAQ 113
            |.||:.|..||..|| ..|  .||.||..:|:
  Rat    64 LSESVAILCYLCRKY-SAPSHWYPPDLHMRAR 94

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/75 (27%)
GstA 22..216 CDD:223698 29/97 (30%)
GST_C_Omega 109..234 CDD:198293 1/5 (20%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 21/78 (27%)