DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and GstD10

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:180 Identity:44/180 - (24%)
Similarity:70/180 - (38%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DAKKIPYHAIYINLRDK----PEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKY-PE 100
            |.|.|      ||.|.:    ||:..:....| :|.|.   :.|. .|.||..|..||.||| .:
  Fly    27 DKKTI------INTRAREQFTPEYLKINPQHT-IPTLH---DHGF-ALWESRAIMVYLVEKYGKD 80

  Fly   101 VPLYPKDLLKKA--QEKILIER---FGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELK--- 157
            ..|:|||:.|:|  .:::..:.   :..|...:|..:....|   .:.::|..:.|..|.|.   
  Fly    81 DKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKP---ANEENYKKIEVAFEFLNTFL 142

  Fly   158 RRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELSPERFPTLIKW 207
            ...|...|||. .:.|.........||...:.|        :|:..:.:|
  Fly   143 EGQTYSAGGDY-SLADIAFLATVSTFDVAGFDF--------KRYANVARW 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 17/57 (30%)
GstA 22..216 CDD:223698 44/180 (24%)
GST_C_Omega 109..234 CDD:198293 19/107 (18%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 18/58 (31%)
PLN02473 3..196 CDD:166114 44/180 (24%)
GST_C_Delta_Epsilon 89..205 CDD:198287 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.