DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO1 and Gstt3

DIOPT Version :9

Sequence 1:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:123 Identity:35/123 - (28%)
Similarity:50/123 - (40%) Gaps:33/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKPVFPDDGILKLYSMRFCPYAHR--VHLVLDAKKIPYHAIYINLRDK----------------- 57
            |:|:       .....|..|.|..  :.|.||....|..|:||..:..                 
  Rat    41 PRPI-------SEVCQRLLPTASAMGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHY 98

  Fly    58 PEWFSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEKYPEVP--LYPKDLLKKAQ 113
            .:.|:.|:...|||||    :.|:.||.||:.|..||..|| :.|  .||:||..:|:
  Rat    99 TDAFAQVNPLRKVPAL----KDGDFVLAESVAILLYLSRKY-KAPDHWYPQDLQTRAR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 26/101 (26%)
GstA 22..216 CDD:223698 33/113 (29%)
GST_C_Omega 109..234 CDD:198293 1/5 (20%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 22/78 (28%)
GST_C_Theta 149..273 CDD:198292 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.